AI & ChatGPT searches , social queries for LL
Search references for LL. Phrases containing LL
See searches and references containing LL!
Search references for LL. Phrases containing LL
See searches and references containing LL!LL
Digraph
Ll or ll is a digraph that occurs in several languages. In English, ⟨ll⟩ often represents the same sound as single ⟨l⟩: /l/. The doubling is used to indicate
Ll
Topics referred to by the same term
LL may refer to: Ll or ll, a digraph that occurs in several natural languages LL, the production code for the 1967 Doctor Who serial The Evil of the Daleks
LL
American rapper (born 1968)
James Todd Smith (born January 14, 1968), known professionally as LL Cool J (short for Ladies Love Cool James), is an American rapper and actor. He is
LL_Cool_J
Top-down parser that parses input from left to right
parser types are LL(*) and LL(finite). A parser is called LL(*)/LL(finite) if it uses the LL(*)/LL(finite) parsing strategy. LL(*) and LL(finite) parsers
LL_parser
American retail company
L.L.Bean is an American privately held retail company that was founded in 1912 by Leon Leonwood Bean. The company, headquartered in Freeport, Maine (where
L.L.Bean
Doctorate in legal studies
A Doctor of Laws (LL.D.) is a doctoral degree in legal studies. The abbreviation LL.D. stands for Legum Doctor, with the double "L" in the abbreviation
Doctor_of_Laws
Motor vehicle
LCD (WiLL PC) WiLL Alkaline ion water conditioner (WiLL A-Pure PJ-A301) WiLL Air purifier (WiLL Ion Conditioner) WiLL Microwave (WiLL Range) WiLL Full automatic
WiLL
Inkosi yamaHlubi
Muziwenkosi Hadebe (born 27 May 1948) widely known as Langalibalele II is the reigning King of the Hlubi people of South Africa. The Hlubi people are still
Langalibalele_ll
Type of postgraduate qualification
A Master of Laws (M.L. or LL.M.; Latin: Magister Legum or Legum Magister) is a postgraduate academic degree, pursued by those either holding an undergraduate
Master_of_Laws
Type of undergraduate qualification
in those institutions. "LLB" stands for Legum Baccalaureus in Latin. The "LL." of the abbreviation for the degree is from the genitive plural legum ("of
Bachelor_of_Laws
Type of a context-free grammar
In formal language theory, an LL grammar is a context-free grammar that can be parsed by an LL parser, which parses the input from Left to right, and constructs
LL_grammar
Group of chondrites with low iron and low metal content
The LL chondrites are a group of stony meteorites, the least abundant group of the ordinary chondrites, accounting for about 10–11% of observed ordinary-chondrite
LL_chondrite
2024 studio album by The Hellp
LL is the second studio album and major-label debut by American band the Hellp. It was released on October 25, 2024, through Atlantic Records under the
LL_(album)
Polish artist (1937–2022)
Diploma of the Association of Polish Art Photographers [pl] (ZPAF). Natalia LL was a conceptual artist and photographer, associated with the avant-garde
Natalia_LL
American police procedural television series
2026–27 television season on CBS. A spin-off of NCIS, the series will feature LL Cool J reprising his character of Sam Hanna from NCIS: Los Angeles, leading
NCIS:_New_York
Specialized Master of Laws degree
Master of European Law (LL.M. Eur) is a specialized Master of Laws (LL.M.) degree, awarded after successful completion of a course of study in the law
Master_of_European_Law
This is the discography of American rapper LL Cool J. Action Bronson - "Strictly 4 My Jeeps (remix)" (w/ Lloyd Banks) (Album: n/a) Alicia Keys - "Teenage
LL_Cool_J_discography
Numerical method for differential equations
In numerical analysis, the local linearization (LL) method is a general strategy for designing numerical integrators for differential equations based on
Local_linearization_method
American band
followed by numerous extended plays and singles. In 2024, their sophomore album LL was released on Atlantic Records. Their third album Riviera was released in
The_Hellp
Variable star in the constellation Pegasus
LL Pegasi (AFGL 3068) is a Mira variable star surrounded by a pinwheel-shaped nebula, IRAS 23166+1655, thought to be a preplanetary nebula. It is a binary
LL_Pegasi
Latin letter L with dot below
In Asturian, a digraph (Ḷḷ, lower case: ḷḷ) is used to represent some western dialectal phonemes corresponding to standard ll (representing a palatal
Ḷ
Biochemical enzyme catalyst
class is LL-2,6-diaminoheptanedioate:2-oxoglutarate aminotransferase. Other names in common use include LL-diaminopimelate transaminase, LL-DAP aminotransferase
L,L-diaminopimelate aminotransferase
L,L-diaminopimelate_aminotransferase
Degree in law
English law, occupying a similar position as the Master of Laws (M.L. or LL.M.; Latin: Magister Legum or Legum Magister) programmes of other British universities
Bachelor_of_Civil_Law
2003 film directed by Gary Hardwick
is a 2003 American romantic comedy film starring LL Cool J and Gabrielle Union, revolving around LL's character, Ray Adams, being paid to date a troublesome
Deliver_Us_from_Eva
Postcode area within the United Kingdom
Template:Attached KML/LL postcode area KML is from Wikidata The LL postcode area, also known as the Llandudno postcode area, is a group of 67 postcode
LL_postcode_area
New Zealand-born Canadian-based law academic
the Fragile Path of Progress (Edward Elgar, June 2008). LL.B. (Canterbury, New Zealand), 1961, LL.M. (Adelaide) 1962, called to the Bar of New Zealand in
Michael_Trebilcock
Family of a Maldivian Monarch
The Family of Iskander ll was a Maldivian family. It is the family of Iskander ll of the Maldives and his ancestors. The family is an origin Family of
Family of Iskander II of the Maldives
Family_of_Iskander_II_of_the_Maldives
1971 studio album by Cowboy
5'll Getcha Ten is the second studio album by American rock band Cowboy. Produced by Johnny Sandlin, the album was released in October 1971 by Capricorn
5'll_Getcha_Ten
Tumblr blog
Your LL Bean Boyfriend is a Tumblr blog showing models from the L.L. Bean catalog with romantic captions. It was started as a joke but has spawned a companion
Your_LL_Bean_Boyfriend
Handheld game console
consoles Japanese: ニンテンドーDSi, Hepburn: Nintendō Dī Esu Ai Japanese: ニンテンドーDSi LL, Hepburn: Nintendō Dī Esu Ai Eru Eru 170,779 units were sold according to
Nintendo_DSi
Binary star in the constellation Aquarius
LL Aquarii is an eclipsing binary star system in the equatorial constellation of Aquarius, abbreviated LL Aqr. At peak brightness it has a combined apparent
LL_Aquarii
Elite Finnish ringette and ice hockey club
Lapinlahden Luistin -89 (abbr. LL-89) in Lapinlahden, from the municipality Pohjois-Savosta, is a home club specializing in ice sports, whose sports include
LL_-89
1985 studio album by LL Cool J
Radio is the debut studio album by American rapper LL Cool J, released on November 18, 1985, by Def Jam Recordings and Columbia Records. It was also Def
Radio_(LL_Cool_J_album)
2023 Indian Bengali TV series
Geeta LL.B. is an Indian Bengali language romantic thriller courtroom drama television series that premiered on 20 November 2023 and ended abruptly on
Geeta_LL.B
1997 studio album by LL Cool J
Phenomenon is the seventh studio album by rapper LL Cool J, released on October 14, 1997, through Def Jam Recordings. After the success of his previous
Phenomenon_(LL_Cool_J_album)
1999 film by Renny Harlin
stars Thomas Jane, Saffron Burrows, Samuel L. Jackson, Michael Rapaport and LL Cool J. The film follows a team of scientists in an isolated underwater facility
Deep_Blue_Sea_(1999_film)
The LL-100 panel is a group of 100 human leukemia and lymphoma cell line, can be used in model of biomedical research. LL-100 panel cell lines cover the
LL-100_panel
Law college in Dehradun, India
and offers a five-year integrated Bachelor of Law (B.A./B.B.A.LL.B) degree, a three-year (LL.B) degree, and a one-year Master of Law (LLM) degree. The college
Siddhartha Law College, Dehradun
Siddhartha_Law_College,_Dehradun
Currency of Lebanon
Lebanese Civil War, USD1 was worth: LL 3.07 in 1965 LL 3.26 in 1970 LL 3 in 1971 LL 2.70 in 1973 LL 2.25 in 1975 about LL 4 in 1981 In 1986, the pound began
Lebanese_pound
Top-down parser utilizing recursion
require backtracking. Predictive parsing is possible only for the class of LL(k) grammars, which are the context-free grammars for which there exists some
Recursive_descent_parser
2002 single by LL Cool J featuring Amerie
American rapper LL Cool J featuring American singer Amerie. The song was released on December 14, 2002, as the second single from LL Cool J's ninth studio
Paradise_(LL_Cool_J_song)
Law University in Cuttack, Odisha
Colony in Cuttack in Odisha. It offers 3 years LL.B.(Hons.), 5 years Integrated B.A., LL.B.(Hons) and 2 years LL.M. course approved from Bar Council of India
Madhusudan_Law_University
1983 single by Rufus and Chaka Khan
Search Results – LL Cool J". Irish Singles Chart. Retrieved August 1, 2023. "Nederlandse Top 40 – LL Cool J" (in Dutch). Dutch Top 40. "LL Cool J – Ain't
Ain't_Nobody
18th century Sultan of the Maldives
Sultan Ibrahim Iskander ll (Arabic: إبراهيم إسكندر الثاني; Dhivehi: އިބްރާހީމް އިސްކަންދަރު ދެވަނަ އެވެ) was the sultan of the Maldives from 1721–1750
Ibrahim_Iskander_II
American sitcom
In the House is an American sitcom television series starring LL Cool J, Debbie Allen, Maia Campbell, Jeffery Wood, Alfonso Ribeiro and Kim Wayans. The
In_the_House_(TV_series)
2024 studio album by LL Cool J
rapper and actor LL Cool J, released on September 6, 2024, by LL Cool J, Inc., Def Jam Recordings, and Virgin Music Group. It is LL Cool J's first official
The_FORCE
2000 studio album by LL Cool J
(simply known as G.O.A.T.) is the eighth studio album by American rapper LL Cool J. Released September 12, 2000, on the Def Jam label, the album topped
G.O.A.T._(LL_Cool_J_album)
1989 single by LL Cool J
single from LL Cool J's third album, Walking with a Panther. It was released in 1989 by Def Jam Recordings and was produced by Dwayne Simon and LL Cool J.
Big_Ole_Butt
the chemical reaction N-succinyl-LL-2,6-diaminoheptanedioate + H2O ⇌ {\displaystyle \rightleftharpoons } succinate + LL-2,6-diaminoheptanedioate Thus, the
Succinyl-diaminopimelate desuccinylase
Succinyl-diaminopimelate_desuccinylase
Classification of soils for road-construction purposes
A-7-5 subgroup is equal to or less than the LL - 30. Plasticity index of A-7-6 subgroup is greater than LL - 30. Hogentogler, C.A.; Terzaghi, K. (May 1929)
AASHTO Soil Classification System
AASHTO_Soil_Classification_System
Rapid transit service
the Brooklyn–Manhattan Transit Corporation's 16 service. The 16 became the LL in 1967 and then the L in 1985. In the early 2000s, the L saw a dramatic increase
L (New York City Subway service)
L_(New_York_City_Subway_service)
Protein family
reaction LL-2,6-diaminoheptanedioate ⇌ {\displaystyle \rightleftharpoons } meso-diaminoheptanedioate Hence, this enzyme has one substrate, LL-2,6-diaminoheptanedioate
Diaminopimelate_epimerase
1999 single by LL Cool J
"Say What" is a single by LL Cool J from the hip-hop compilation, Violator: The Album. It was released on August 3, 1999 for Violator Records and Def Jam
Say_What_(LL_Cool_J_song)
Law college in Odisha
Dhenkanal in the Indian state of Odisha. It offers 3 years LL.B. and 2 years Master of Laws (LL.M) courses approved by the Bar Council of India (BCI) and
Dhenkanal_Law_College
catalyzes the chemical reaction N-acetyl-LL-2,6-diaminoheptanedioate + H2O ⇌ {\displaystyle \rightleftharpoons } acetate + LL-2,6-diaminoheptanedioate Thus, the
N-acetyldiaminopimelate deacetylase
N-acetyldiaminopimelate_deacetylase
2025 referendum
Colorado Proposition LL, officially the Allow State to Retain Revenue From Proposition FF Measure, is a legislatively referred state statute that appeared
2025_Colorado_Proposition_LL
Law college in Punjab, India
Rupnagar in the Indian state of Punjab. It offers 5 year Integrated B.A. LL.B. and B.Com LL.B. courses approved by Bar Council of India (BCI), New Delhi and affiliated
Rayat_College_of_Law
Dwarf galaxy in the local group
Aquarius ll (also Aquarius 2, AQU 2 or Aqu ll) is a mildly elliptical dwarf satellite galaxy to the Milky Way located around 110 kiloparsecs[contradictory]
Aquarius_II
Law college in Andhra Pradesh
Indian state of Andhra Pradesh. The college offers 3 years LL.B. and five-years integrated LL.B. courses approved by the Bar Council of India (BCI), New
Sri Venkateswara College of Law
Sri_Venkateswara_College_of_Law
CPU instructions which read and modify an unaltered value in memory
In computer science, load-linked/store-conditional (LL/SC), sometimes known as load-reserved/store-conditional (LR/SC), are a pair of instructions used
Load-link/store-conditional
Painting by James Tissot
Portrait of Mademoiselle L.L. (French: Portrait de Mademoiselle L.L.) is an 1864 oil painting by the French artist James Tissot. It depicts a young woman
Portrait_of_Mademoiselle_L.L.
2002 studio album by LL Cool J
studio album by American rapper LL Cool J. It was released by Def Jam Recordings on October 15, 2002, in the United States. LL Cool J and 10 hit a milestone
10_(LL_Cool_J_album)
Children's baseball tournament
with the most championships (8); the Whalley LL of Surrey, British Columbia has seven; and Glace Bay LL and Trail are third with five. The Prairie Provinces
Little League World Series in Canada
Little_League_World_Series_in_Canada
Poem by E. E. Cummings
l(a le af fa ll s) one l iness — E. E. Cummings "l(a" is a poem by E. E. Cummings. It is the first poem in his 1958 collection 95 Poems. "l(a" is arranged
L(a
program resulting in a Bachelor of Law (LL.B.) or a postgraduate degree resulting in a Masters of Law (LL.M.). Some LL.M. programs in Taiwan are offered to
List_of_law_schools_in_Taiwan
1989 studio album by LL Cool J
a Panther is the third studio album by American hip hop recording artist LL Cool J, released June 9, 1989, on Def Jam Recordings. While his previous album
Walking_with_a_Panther
French for LL.B. and most LL.M. programs, with the J.D. and LL.D. program being bilingual French-English and some programs (such as the LL.M. in Business
Université de Montréal Faculty of Law
Université_de_Montréal_Faculty_of_Law
Handheld game console
Newニンテンドー3DS, Hepburn: Nyū Nintendō Surī Dī Esu Called the New Nintendo 3DS LL (Newニンテンドー3DS LL) in Japan "New Nintendo 3DS to be released in South Korea". Bulbanews
New_Nintendo_3DS
1996 single by LL Cool J
"Doin It" is a song by American rapper LL Cool J, released by Def Jam Recordings on February 20, 1996, as the second single from his sixth album, Mr. Smith
Doin'_It_(LL_Cool_J_song)
Chemical enriched dwarf galaxy
Grus ll is an ultra-faint dwarf galaxy (UFD) located at a distance of 55 kiloparsecs from the Milky Way in the constellation of Grus. It has a higher than
Grus_II
2004 single by LL Cool J
"Hush" is the second single from American rapper LL Cool J's tenth studio album, The DEFinition (2004). Produced by 7 Aurelius, who provides additional
Hush_(LL_Cool_J_song)
Letter of the Latin alphabet
Ł (minuscule: ł), known as L with stroke, is a Latin-script letter. It is used in the Polish, Kashubian, Sorbian, Silesian, Belarusian Latin, Ukrainian
Ł
Typographical symbol
This page uses IPA notation for orthographic or other linguistic analysis. For the meaning of how ⟨ ⟩, | |, / /, and [ ] are used here, see this page.
Middle_dot
Law college in Odisha
district in the Indian state of Odisha. It offers 3-year LL.B. and 2-year Master of Laws (LL.M) courses approved by the Bar Council of India (BCI) and
Mayurbhanj_Law_College
American businessman and educator (1853–1925)
ISBN 9780810832879 L.L. Nunn timeline from Fort Lewis College Foundation, Center of Southwest Studies L.L. Nunn papers from Cornell University L.L. Nunn page
L._L._Nunn
1997 single by LL Cool J
"Phenomenon" is the a song by American rapper LL Cool J, released as the lead single from his seventh studio album, Phenomenon (1997). It samples the Creative
Phenomenon_(LL_Cool_J_song)
2003 film directed by Clark Johnson
Jim McClain. It stars Samuel L. Jackson, Colin Farrell, Michelle Rodriguez, LL Cool J, Josh Charles, Jeremy Renner, Brian Van Holt and Olivier Martinez with
S.W.A.T._(2003_film)
Hardwood flooring retailer
its name to LL Flooring. The corporate entity name was changed to LL Flooring Holdings, Inc. effective January 1, 2022. In July 2024, LL Flooring warned
Lumber_Liquidators
Law college in Assam
state of Assam. It offers 3 years law courses, 5 Year Integrated B.A. LL.B.and LL.B. courses affiliated to Dibrugarh University. This College is recognised
Jorhat_Law_College
Law college in Kerala
are selected through a state level entrance test. The college offers LL.B and LL.M courses. The city has a court complex that is more than two centuries
Government Law College, Kozhikode
Government_Law_College,_Kozhikode
1990 studio album by LL Cool J
Mama Said Knock You Out is the fourth studio album by American rapper LL Cool J. It was produced mostly by Marley Marl and recorded at his "House of Hits"
Mama_Said_Knock_You_Out
Law college in Assam
Honours Law courses in three different streams, such as BB.A., LL.B. (Hons.), B.A., LL.B. (Hons.).courses affiliated to Dibrugarh University. This College
S.I.P.E._Law_College
courses - LL.B. (3 years), B.A. LL.B (5 years), B. Ed. JCL is one of the first law colleges to offer the integrated degree course of B.A. LL.B. and LL.B. (3
Janhit_College_of_Law
List of law schools in Haryana, India
One can pursue his or her study in various law courses such as LL.B, integrated LL.B, LL.M and doctoral courses. LLB is an undergraduate degree that covers
List of law schools in Haryana
List_of_law_schools_in_Haryana
1987 single by LL Cool J
"I'm Bad" (sometimes written as I'm BAD) is the first single from LL Cool J's second album, Bigger and Deffer. It was released in 1987 for Def Jam Recordings
I'm_Bad
Law college in Gujarat
(BCI), New Delhi. It offers three years undergraduate course (LL.B. or Bachelor of Law) and LL.M. degree in legal education affiliated to the Gujarat University
L.A._Shah_Law_College
American actress and fashion designer
Sunday. Jones dated rapper and actor LL Cool J from 1992 to 1994. In his autobiography, I Make My Own Rules, LL Cool J stated that he ended their relationship
Kidada_Jones
This list of cities, towns, unincorporated communities, counties, and other recognized places in the U.S. state of Pennsylvania also includes information
List of places in Pennsylvania: La–Ll
List_of_places_in_Pennsylvania:_La–Ll
2000 single by LL Cool J
"Imagine That" is a song by LL Cool J released as the lead single from his eighth album, G.O.A.T. It was released on June 27, 2000 for Def Jam Recordings
Imagine_That_(LL_Cool_J_song)
1990 single by Sonic Youth
Gordon conducted with LL Cool J for Spin. Although he is never mentioned by name, the song's lyrics contain several references to LL Cool J. Gordon's lyrics
Kool_Thing
American lawyer (1924–1992)
Gregory Hayes Swanson, LL.B, A.B., (born 1924 – July 26, 1992) was an American lawyer who was the first African American to attend the University of Virginia
Gregory_Swanson
1995 film directed by Debbie Allen
Out-of-Sync is a 1995 American crime drama film featuring LL Cool J in his first starring role. Directed by Debbie Allen, the movie co-starred Victoria
Out-of-Sync
2017 Indian film by Subhash Kapoor
Jolly LLB 2 (marketed as The State vs. Jolly LL.B 2) is a 2017 Indian Hindi-language legal comedy drama film written and directed by Subhash Kapoor. A
Jolly_LLB_2
Dwarf nova star in the constellation Andromeda
LL Andromedae (often abbreviated to LL And) is a dwarf nova in the constellation Andromeda, discovered during an outburst in 1979. Its typical apparent
LL_Andromedae
English clergyman, journalist and philanthropist
Robert Fellowes, LL.D. (1771 – 6 February 1847) was an English clergyman, journalist and philanthropist. His father William Fellowes of Danbury was the
Robert Fellowes (philanthropist)
Robert_Fellowes_(philanthropist)
Group of antimicrobial peptides in vertebrates
antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa]
Cathelicidin antimicrobial peptide
Cathelicidin_antimicrobial_peptide
Law college in Punjab, India
Amritsar in the Indian state of Punjab. It offers 5 year Integrated B.A. LL.B., B.Com LL.B. and 3 years law courses approved by Bar Council of India (BCI),
Khalsa_College_of_Law
2024 studio album by Lamin
SkyLL is the third solo studio album by Danish rapper and songwriter Lamin. It was released by Force Majeure Records, under the Universal Music Denmark
SkyLL
Law University in Madhya Pradesh, India
A. LL.B. course and around 60 candidates for the B.Sc. LL.B. course. The postgraduate courses offered at the university are the Masters of Law (LL.M.)
NLIU_Bhopal
Terminal research doctoral degree in law
can be earned, higher than the Master of Laws (LL.M.), Juris Doctor (J.D.), and Bachelor of Laws (LL.B.). The SJD is offered by the Australian National
Doctor_of_Juridical_Science
LL
LL
Female
French
Feminine form of French Noël, NOËLLE means "day of birth."
Male
Icelandic
Icelandic form of Greek Paulos, PÃLL means "small."
Female
French
 Feminine form of French Joël, JOËLLE means "Jehovah is God" or "to whom Jehovah is God."
Surname or Lastname
South German (Düll)
South German (Düll) : nickname for a stubborn man.German (Düll) : variant of Dill 5.English : unexplained.
Female
Welsh
Welsh form of Roman Latin Lucia, LLEULU means "light."
Male
Welsh
Variant spelling of Welsh Llywelyn, LLYWELLYN means "oath of Belenus."Â
Male
Welsh
Welsh name LLŶR means "the sea." In mythology, this is the name of a god of the sea. Identified with Irish Lir.
Female
Welsh
Feminine form of Welsh Llewelyn, LLEWELLA means "oath of Belenus."Â
Male
Welsh
Variant spelling of Welsh Llewelyn, LLEWELLYN means "oath of Belenus."Â
Surname or Lastname
English, Scottish, and North German (also Töller)
English, Scottish, and North German (also Töller) : occupational name for a toll taker or tax collector, from an agent derivative of Middle English toll ‘tax’, ‘payment’, Middle Low German toll (from Late Latin toloneum, teloneum, a derivative of Greek telos ‘tax’).English : habitational name from Toller in Dorset, named from a British river name, apparently composed of elements akin to Welsh toll ‘hollow’, ‘pierced’ + dw(f)r ‘stream’.German : from a short form of the personal name Bartholomäus (see Bartholomew).German : nickname meaning ‘foolish one’ or ‘handsome one’; a noun derivative of Toll 3.
Surname or Lastname
German (Pöllmann)
German (Pöllmann) : from a short form of a personal name formed with Old High German bald ‘bold’ + man ‘man’.North German : variant of Pohlmann 1.South German variant of Bollmann.English : variant spelling of Polman.
Male
Welsh
Variant spelling of Welsh Llywelyn, LLEWELYN means "oath of Belenus."Â
Surname or Lastname
Americanized form of German Möller (see Moeller).German
Americanized form of German Möller (see Moeller).German : habitational name for someone from Melle.German, Jewish (Ashkenazic), and Polish : occupational name for a miller or flour merchant, from an agent derivative of German Mehl ‘flour’.English : variant of Miller.
Female
French
Possibly a contracted form of French Gwenaëlle, GAËLLE means "holy and generous."
Female
French
Feminine form of French Gwenaël, GWENAËLLE means "holy and generous."
Male
Welsh
Late Welsh form of the ancient Celtic name Lugobelinos, LLYWELYN means "oath of Belenus."Â
Boy/Male
Welsh
Legendary son of Llassar Llaes.
Male
Welsh
Welsh form of Irish Lugh, LLEU means "oath." In Welsh mythology, this is the name of a son of Aranrhod, and twin brother to Dylan.
Male
Welsh
Welsh surname transferred to forename use, derived from Celtic Llwyd, LLOYD means "gray-haired."Â
Female
Welsh
Welsh name LLINOS means "greenfinch (bird)."
LL
LL
Surname or Lastname
English
English : metonymic occupational name for a seaman, from Middle English galy(e) ‘ship’, ‘barge’ (Old French galie, of uncertain origin).English : nickname for someone who had been on a pilgrimage to the Holy Land, from a reduced form of the place name Galilee.Scottish : variant of Gall 1, from the derivative gallda or the collective form gallaich.German : presumably a derivative of Gall.Northern French : variant of Gallet. This name is also found in French Switzerland and may have been brought to the U.S. from there.
Boy/Male
Hindu, Indian, Kannada, Malayalam, Marathi, Telugu
With a Cute Personality; Someone who is Different with a Cute Personality
Girl/Female
English American
Abbreviation of Natasha - the Russian form of the English Natalie: born at Christmas.
Boy/Male
Australian, German, Latin
Light
Boy/Male
Muslim/Islamic
Forgiver
Girl/Female
English American
Derived from an Irish Gaelic of Helen: (light;beautiful woman);.
Boy/Male
German, Parsi
Garland of Flowers
Boy/Male
Assamese, Hindu, Indian, Kannada, Marathi, Oriya, Telugu
A Raga
Girl/Female
Muslim/Islamic
Nearness closeness
Surname or Lastname
English
English : variant of Edgar.Hungarian : habitational name for someone from any of various places called Eger, in Fehér, Heves, and Zala counties, or former Nyitra county, now in Slovakia. In some cases the name may derive from éger ‘alder’.German : habitational name from Eger in western Bohemia (Czech name Cheb).
LL
LL
LL
LL
LL
superl.
Made with a somewhat elevated position of some certain part of the tongue, in relation to the palate; midway between the high and the low; -- said of certain vowel sounds; as, a (ale), / (/ll), / (/ld). See Guide to Pronunciation, // 10, 11.
pl.
of Llano
n.
A South American ruminant (Auchenia llama), allied to the camels, but much smaller and without a hump. It is supposed to be a domesticated variety of the guanaco. It was formerly much used as a beast of burden in the Andes.
n.
One half of the axis of an /llipse or other figure.
n.
A large ruminant used in Asia and Africa for carrying burdens and for riding. The camel is remarkable for its ability to go a long time without drinking. Its hoofs are small, and situated at the extremities of the toes, and the weight of the animal rests on the callous. The dromedary (Camelus dromedarius) has one bunch on the back, while the Bactrian camel (C. Bactrianus) has two. The llama, alpaca, and vicua, of South America, belong to a related genus (Auchenia).
n.
A defect in pronunciation of the letter l when doubled, which consists in giving it a sound as if followed by y, similar to that of the letters lli in billion.
n.
See Karyoplasma. L () L is the twelfth letter of the English alphabet, and a vocal consonant. It is usually called a semivowel or liquid. Its form and value are from the Greek, through the Latin, the form of the Greek letter being from the Phoenician, and the ultimate origin prob. Egyptian. Etymologically, it is most closely related to r and u; as in pilgrim, peregrine, couch (fr. collocare), aubura (fr. LL. alburnus).
n.
An extinct genus of herbivorous Tertiary mammals, once supposed to have resembled the tapir in form, but now known to have had a more slender form, with a long neck like that of a llama.
n.
See Llama.
n.
An association of underwriters and others in London, for the collection and diffusion of marine intelligence, the insurance, classification, registration, and certifying of vessels, and the transaction of business of various kinds connected with shipping.
a.
Applied to certain consonants having a "liquid" or softened sound; e.g., in French, l or ll and gn (like the lli in million and ni in minion); in Italian, gl and gn; in Spanish, ll and ; in Portuguese, lh and nh.
n.
The llama.
n.
One of the inhabitants of the llanos of South America.
n.
One of the adherents of Charles L. or Charles LL.; -- so called by the opposite party.
n.
A South American mammal (Auchenia vicunna) native of the elevated plains of the Andes, allied to the llama but smaller. It has a thick coat of very fine reddish brown wool, and long, pendent white hair on the breast and belly. It is hunted for its wool and flesh.
n.
An extensive plain with or without vegetation.
superl.
Made, as a vowel, with a less tense, and more open and relaxed, condition of the mouth organs; -- opposed to primary as used by Mr. Bell, and to narrow as used by Mr. Sweet. The effect, as explained by Mr. Bell, is due to the relaxation or tension of the pharynx; as explained by Mr. Sweet and others, it is due to the action of the tongue. The wide of / (/ve) is / (/ll); of a (ate) is / (/nd), etc. See Guide to Pronunciation, / 13-15.
n.
A part of the Royal Exchange, in London, appropriated to the use of underwriters and insurance brokers; -- called also Lloyd's Rooms.